Product Number |
ARP83971_P050 |
Product Page |
www.avivasysbio.com/numb-antibody-c-terminal-region-arp83971-p050.html |
Name |
NUMB Antibody - C-terminal region (ARP83971_P050) |
Protein Size (# AA) |
456 amino acids |
Molecular Weight |
50 kDa |
NCBI Gene Id |
8650 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
numb homolog (Drosophila) |
Alias Symbols |
S171, C14orf41, c14_5527 |
Peptide Sequence |
Synthetic peptide located within the following region: DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NUMB (ARP83971_P050) antibody |
Blocking Peptide |
For anti-NUMB (ARP83971_P050) antibody is Catalog # AAP83971 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NUMB |
Uniprot ID |
P49757-7 |
Protein Name |
protein numb homolog |
Protein Accession # |
NP_001005743.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001005743.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
NUMB |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human MCF7 Whole Cell
| Host: Rabbit Target Name: NUMB Sample Tissue: Human MCF7 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|