NUMB Antibody - C-terminal region (ARP83971_P050)

Data Sheet
 
Product Number ARP83971_P050
Product Page www.avivasysbio.com/numb-antibody-c-terminal-region-arp83971-p050.html
Name NUMB Antibody - C-terminal region (ARP83971_P050)
Protein Size (# AA) 456 amino acids
Molecular Weight 50 kDa
NCBI Gene Id 8650
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name numb homolog (Drosophila)
Alias Symbols S171, C14orf41, c14_5527
Peptide Sequence Synthetic peptide located within the following region: DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NUMB (ARP83971_P050) antibody
Blocking Peptide For anti-NUMB (ARP83971_P050) antibody is Catalog # AAP83971
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NUMB
Uniprot ID P49757-7
Protein Name protein numb homolog
Protein Accession # NP_001005743.1
Purification Affinity purified
Nucleotide Accession # NM_001005743.1
Tested Species Reactivity Human
Gene Symbol NUMB
Predicted Species Reactivity Human
Application WB
Image 1
Human MCF7 Whole Cell
Host: Rabbit
Target Name: NUMB
Sample Tissue: Human MCF7 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com