PTK2 Antibody - middle region (ARP83893_P050)

Data Sheet
 
Product Number ARP83893_P050
Product Page www.avivasysbio.com/ptk2-antibody-middle-region-arp83893-p050.html
Name PTK2 Antibody - middle region (ARP83893_P050)
Protein Size (# AA) 1052 amino acids
Molecular Weight 115 kDa
NCBI Gene Id 5747
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name protein tyrosine kinase 2
Alias Symbols FAK, FADK, FAK1, FRNK, FADK 1, PPP1R71, p125FAK, pp125FAK
Peptide Sequence Synthetic peptide located within the following region: SWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene, but the full-length natures of only four of them have been determined.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PTK2 (ARP83893_P050) antibody
Blocking Peptide For anti-PTK2 (ARP83893_P050) antibody is Catalog # AAP83893
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PTK2
Uniprot ID Q05397
Protein Name focal adhesion kinase 1
Protein Accession # NP_001186578.1
Purification Affinity purified
Nucleotide Accession # NM_001199649.1
Tested Species Reactivity Human
Gene Symbol PTK2
Predicted Species Reactivity Human
Application WB
Image 1
Human 786-0 Whole Cell
Host: Rabbit
Target Name: PTK2
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com