Product Number |
ARP83893_P050 |
Product Page |
www.avivasysbio.com/ptk2-antibody-middle-region-arp83893-p050.html |
Name |
PTK2 Antibody - middle region (ARP83893_P050) |
Protein Size (# AA) |
1052 amino acids |
Molecular Weight |
115 kDa |
NCBI Gene Id |
5747 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
protein tyrosine kinase 2 |
Alias Symbols |
FAK, FADK, FAK1, FRNK, FADK 1, PPP1R71, p125FAK, pp125FAK |
Peptide Sequence |
Synthetic peptide located within the following region: SWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a cytoplasmic protein tyrosine kinase which is found concentrated in the focal adhesions that form between cells growing in the presence of extracellular matrix constituents. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Activation of this gene may be an important early step in cell growth and intracellular signal transduction pathways triggered in response to certain neural peptides or to cell interactions with the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene, but the full-length natures of only four of them have been determined. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PTK2 (ARP83893_P050) antibody |
Blocking Peptide |
For anti-PTK2 (ARP83893_P050) antibody is Catalog # AAP83893 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PTK2 |
Uniprot ID |
Q05397 |
Protein Name |
focal adhesion kinase 1 |
Protein Accession # |
NP_001186578.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001199649.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
PTK2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: PTK2 Sample Tissue: Human 786-0 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|