MOG Antibody - middle region (ARP83852_P050)

• Product Number: ARP83852_P050
• Name: MOG Antibody - middle region (ARP83852_P050)
• Protein Size (# AA): 208 amino acids
• Molecular Weight: 25 kDa
• NCBI Gene Id: 4340
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: myelin oligodendrocyte glycoprotein
• Alias Symbols: BTN6, BTNL11, MOGIG2, NRCLP7
• Peptide Sequence: Synthetic peptide located within the following region: VELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MOG (ARP83852_P050) antibody is Catalog # AAP83852
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MOG
• Uniprot ID: Q16653-3
• Protein Name: myelin-oligodendrocyte glycoprotein
• Protein Accession #: NP_001008229.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001008228.2
• Tested Species Reactivity: Human
• Gene Symbol: MOG
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Leiomyosarcoma Tumor
  
  Host: Rabbit
  Target Name: MOG
  Sample Tissue: Human Leiomyosarcoma Tumor lysates
  Antibody Dilution: 1ug/ml