MARC1 Antibody - middle region (ARP83654_P050)

Data Sheet
 
Product Number ARP83654_P050
Product Page www.avivasysbio.com/marc1-antibody-middle-region-arp83654-p050.html
Name MARC1 Antibody - middle region (ARP83654_P050)
Protein Size (# AA) 337 amino acids
Molecular Weight 37 kDa
NCBI Gene Id 64757
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name mitochondrial amidoxime reducing component 1
Alias Symbols MARC1, MOSC1
Peptide Sequence Synthetic peptide located within the following region: CTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MARC1 (ARP83654_P050) antibody
Blocking Peptide For anti-MARC1 (ARP83654_P050) antibody is Catalog # AAP83654
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MOSC1
Uniprot ID Q5VT66
Protein Name mitochondrial amidoxime-reducing component 1
Protein Accession # NP_073583.3
Purification Affinity purified
Nucleotide Accession # NM_022746.3
Tested Species Reactivity Human
Gene Symbol MARC1
Predicted Species Reactivity Human
Application WB
Image 1
Human HCT15 Whole Cell
Host: Rabbit
Target Name: MOSC1
Sample Tissue: Human HCT15 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com