Product Number |
ARP83654_P050 |
Product Page |
www.avivasysbio.com/marc1-antibody-middle-region-arp83654-p050.html |
Name |
MARC1 Antibody - middle region (ARP83654_P050) |
Protein Size (# AA) |
337 amino acids |
Molecular Weight |
37 kDa |
NCBI Gene Id |
64757 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
mitochondrial amidoxime reducing component 1 |
Alias Symbols |
MARC1, MOSC1 |
Peptide Sequence |
Synthetic peptide located within the following region: CTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MARC1 (ARP83654_P050) antibody |
Blocking Peptide |
For anti-MARC1 (ARP83654_P050) antibody is Catalog # AAP83654 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MOSC1 |
Uniprot ID |
Q5VT66 |
Protein Name |
mitochondrial amidoxime-reducing component 1 |
Protein Accession # |
NP_073583.3 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_022746.3 |
Tested Species Reactivity |
Human |
Gene Symbol |
MARC1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human HCT15 Whole Cell
| Host: Rabbit Target Name: MOSC1 Sample Tissue: Human HCT15 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|