| Product Number |
ARP83049_P050 |
| Product Page |
www.avivasysbio.com/bcl7c-antibody-middle-region-arp83049-p050.html |
| Name |
BCL7C Antibody - middle region (ARP83049_P050) |
| Protein Size (# AA) |
242 amino acids |
| Molecular Weight |
26 kDa |
| NCBI Gene Id |
9274 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
B-cell CLL/lymphoma 7C |
| Peptide Sequence |
Synthetic peptide located within the following region: GRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BCL7C (ARP83049_P050) antibody |
| Blocking Peptide |
For anti-BCL7C (ARP83049_P050) antibody is Catalog # AAP83049 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human BCL7C |
| Uniprot ID |
Q8WUZ0-2 |
| Protein Name |
B-cell CLL/lymphoma 7 protein family member C |
| Protein Accession # |
NP_001273455.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001286526.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BCL7C |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HCT116 Whole Cell
 | Host: Rabbit
Target Name: BCL7C
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
