Product Number |
ARP83002_P050 |
Product Page |
www.avivasysbio.com/pnma2-antibody-c-terminal-region-arp83002-p050.html |
Name |
PNMA2 Antibody - C-terminal region (ARP83002_P050) |
Protein Size (# AA) |
364 amino acids |
Molecular Weight |
42 kDa |
NCBI Gene Id |
10687 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
paraneoplastic Ma antigen 2 |
Alias Symbols |
MA2, MM2, RGAG2 |
Peptide Sequence |
Synthetic peptide located within the following region: LKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEERDGYGRWNHEGDD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Antibodies against PNMA2 are present in sera from patients suffering of paraneoplastic neurological disorders. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PNMA2 (ARP83002_P050) antibody |
Blocking Peptide |
For anti-PNMA2 (ARP83002_P050) antibody is Catalog # AAP83002 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PNMA2 |
Uniprot ID |
Q9UL42 |
Protein Name |
paraneoplastic antigen Ma2 |
Protein Accession # |
NP_009188.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_007257.5 |
Tested Species Reactivity |
Human |
Gene Symbol |
PNMA2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human HCT116 Whole Cell
| Host: Rabbit Target Name: PNMA2 Sample Tissue: Human HCT116 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|