| Product Number |
ARP83002_P050 |
| Product Page |
www.avivasysbio.com/pnma2-antibody-c-terminal-region-arp83002-p050.html |
| Name |
PNMA2 Antibody - C-terminal region (ARP83002_P050) |
| Protein Size (# AA) |
364 amino acids |
| Molecular Weight |
42 kDa |
| NCBI Gene Id |
10687 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
paraneoplastic Ma antigen 2 |
| Alias Symbols |
MA2, MM2, RGAG2 |
| Peptide Sequence |
Synthetic peptide located within the following region: LKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEERDGYGRWNHEGDD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Antibodies against PNMA2 are present in sera from patients suffering of paraneoplastic neurological disorders. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PNMA2 (ARP83002_P050) antibody |
| Blocking Peptide |
For anti-PNMA2 (ARP83002_P050) antibody is Catalog # AAP83002 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PNMA2 |
| Uniprot ID |
Q9UL42 |
| Protein Name |
paraneoplastic antigen Ma2 |
| Protein Accession # |
NP_009188.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_007257.5 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PNMA2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HCT116 Whole Cell
 | Host: Rabbit
Target Name: PNMA2
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
