NDUFB7 Antibody - middle region (ARP82995_P050)

• Product Number: ARP82995_P050
• Name: NDUFB7 Antibody - middle region (ARP82995_P050)
• Protein Size (# AA): 137 amino acids
• Molecular Weight: 15 kDa
• NCBI Gene Id: 4713
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: NADH:ubiquinone oxidoreductase subunit B7
• Alias Symbols: B18, CI-B18
• Peptide Sequence: Synthetic peptide located within the following region: KCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NDUFB7 (ARP82995_P050) antibody is Catalog # AAP82995
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFB7
• Uniprot ID: P17568
• Protein Name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
• Protein Accession #: NP_004137.2
• Purification: Affinity purified
• Nucleotide Accession #: NM_004146.5
• Tested Species Reactivity: Human
• Gene Symbol: NDUFB7
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: NDUFB7
  Sample Tissue: Human Jurkat Whole Cell lysates
  Antibody Dilution: 1ug/ml