| Product Number |
ARP82970_P050 |
| Product Page |
www.avivasysbio.com/exosc9-antibody-middle-region-arp82970-p050.html |
| Name |
EXOSC9 Antibody - middle region (ARP82970_P050) |
| Protein Size (# AA) |
439 amino acids |
| Molecular Weight |
48 kDa |
| NCBI Gene Id |
5393 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
exosome component 9 |
| Alias Symbols |
p5, p6, PCH1D, RRP45, PMSCL1, Rrp45p, PM/Scl-75 |
| Peptide Sequence |
Synthetic peptide located within the following region: IIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDLEDSEKEDDEGGGDQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-EXOSC9 (ARP82970_P050) antibody |
| Blocking Peptide |
For anti-EXOSC9 (ARP82970_P050) antibody is Catalog # AAP82970 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EXOSC9 |
| Uniprot ID |
Q06265 |
| Protein Name |
exosome complex component RRP45 |
| Protein Accession # |
NP_001029366.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001034194.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EXOSC9 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Hela Whole Cell
 | Host: Rabbit
Target Name: EXOSC9
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
