Product Number |
ARP82373_P050 |
Product Page |
www.avivasysbio.com/cd2bp2-antibody-n-terminal-region-arp82373-p050.html |
Name |
CD2BP2 Antibody - N-terminal region (ARP82373_P050) |
Protein Size (# AA) |
341 amino acids |
Molecular Weight |
37 kDa |
NCBI Gene Id |
10421 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
CD2 (cytoplasmic tail) binding protein 2 |
Alias Symbols |
LIN1, Snu40, FWP010, U5-52K, PPP1R59 |
Peptide Sequence |
Synthetic peptide located within the following region: KHSLDSDEEEDDDDGGSSKYDILASEDVEGQEAATLPSEGGVRITPFNLQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a bi-functional protein. In the cytoplasm, the encoded protein binds the cytoplasmic tail of human surface antigen CD2 via its C-terminal GYF domain, and regulate CD2-triggered T lymphocyte activation. In the nucleus, this protein is a component of the U5 small nuclear ribonucleoprotein complex and is involved in RNA splicing. A pseudogene has been identified on chromosome 7. Alternative splicing results in multiple transcript variants but their biological validity has not been determined. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CD2BP2 (ARP82373_P050) antibody |
Blocking Peptide |
For anti-CD2BP2 (ARP82373_P050) antibody is Catalog # AAP82373 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CD2BP2 |
Uniprot ID |
O95400 |
Protein Name |
CD2 antigen cytoplasmic tail-binding protein 2 |
Protein Accession # |
NP_001230575.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001243646.1 |
Tested Species Reactivity |
Human |
Gene Symbol |
CD2BP2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: CD2BP2 Sample Tissue: Human Jurkat Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|