CD2BP2 Antibody - N-terminal region (ARP82373_P050)

Data Sheet
 
Product Number ARP82373_P050
Product Page www.avivasysbio.com/cd2bp2-antibody-n-terminal-region-arp82373-p050.html
Name CD2BP2 Antibody - N-terminal region (ARP82373_P050)
Protein Size (# AA) 341 amino acids
Molecular Weight 37 kDa
NCBI Gene Id 10421
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name CD2 (cytoplasmic tail) binding protein 2
Alias Symbols LIN1, Snu40, FWP010, U5-52K, PPP1R59
Peptide Sequence Synthetic peptide located within the following region: KHSLDSDEEEDDDDGGSSKYDILASEDVEGQEAATLPSEGGVRITPFNLQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a bi-functional protein. In the cytoplasm, the encoded protein binds the cytoplasmic tail of human surface antigen CD2 via its C-terminal GYF domain, and regulate CD2-triggered T lymphocyte activation. In the nucleus, this protein is a component of the U5 small nuclear ribonucleoprotein complex and is involved in RNA splicing. A pseudogene has been identified on chromosome 7. Alternative splicing results in multiple transcript variants but their biological validity has not been determined.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CD2BP2 (ARP82373_P050) antibody
Blocking Peptide For anti-CD2BP2 (ARP82373_P050) antibody is Catalog # AAP82373
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CD2BP2
Uniprot ID O95400
Protein Name CD2 antigen cytoplasmic tail-binding protein 2
Protein Accession # NP_001230575.1
Purification Affinity purified
Nucleotide Accession # NM_001243646.1
Tested Species Reactivity Human
Gene Symbol CD2BP2
Predicted Species Reactivity Human
Application WB
Image 1
Human Jurkat Whole Cell
Host: Rabbit
Target Name: CD2BP2
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com