| Product Number |
ARP82142_P050 |
| Product Page |
www.avivasysbio.com/impa2-antibody-c-terminal-region-arp82142-p050.html |
| Name |
IMPA2 Antibody - C-terminal region (ARP82142_P050) |
| Protein Size (# AA) |
288 amino acids |
| Molecular Weight |
31 kDa |
| NCBI Gene Id |
3613 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
inositol(myo)-1(or 4)-monophosphatase 2 |
| Peptide Sequence |
Synthetic peptide located within the following region: IREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IMPA2 (ARP82142_P050) antibody |
| Blocking Peptide |
For anti-IMPA2 (ARP82142_P050) antibody is Catalog # AAP82142 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of Human IMPA2 |
| Uniprot ID |
O14732 |
| Protein Name |
inositol monophosphatase 2 |
| Protein Accession # |
NP_055029.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_014214.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IMPA2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human LN18 Whole Cell
 | Host: Rabbit
Target Name: IMPA2
Sample Tissue: Human LN18 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
