| Product Number |
ARP82090_P050 |
| Product Page |
www.avivasysbio.com/tbxas1-antibody-middle-region-arp82090-p050.html |
| Name |
TBXAS1 Antibody - middle region (ARP82090_P050) |
| Protein Size (# AA) |
466 amino acids |
| Molecular Weight |
51 kDa |
| NCBI Gene Id |
6916 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
thromboxane A synthase 1 |
| Alias Symbols |
TS, TXS, CYP5, THAS, TXAS, CYP5A1, GHOSAL, BDPLT14 |
| Peptide Sequence |
Synthetic peptide located within the following region: DPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEVK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TBXAS1 (ARP82090_P050) antibody |
| Blocking Peptide |
For anti-TBXAS1 (ARP82090_P050) antibody is Catalog # AAP82090 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TBXAS1 |
| Uniprot ID |
P24557-2 |
| Protein Name |
thromboxane-A synthase |
| Protein Accession # |
NP_001052.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001061.4 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TBXAS1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: TBXAS1
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
