Product Number |
ARP81924_P050 |
Product Page |
www.avivasysbio.com/gfra3-antibody-middle-region-arp81924-p050.html |
Name |
GFRA3 Antibody - middle region (ARP81924_P050) |
Protein Size (# AA) |
400 amino acids |
Molecular Weight |
44 kDa |
NCBI Gene Id |
2676 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
GDNF family receptor alpha 3 |
Alias Symbols |
GDNFR3 |
Peptide Sequence |
Synthetic peptide located within the following region: CLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GFRA3 (ARP81924_P050) antibody |
Blocking Peptide |
For anti-GFRA3 (ARP81924_P050) antibody is Catalog # AAP81924 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GFRA3 |
Uniprot ID |
O60609 |
Protein Name |
GDNF family receptor alpha-3 |
Protein Accession # |
NP_001487.2 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001496.3 |
Tested Species Reactivity |
Human |
Gene Symbol |
GFRA3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human DLD1 Whole Cell
| Host: Rabbit Target Name: GFRA3 Sample Tissue: Human DLD1 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|