GFRA3 Antibody - middle region (ARP81924_P050)

Data Sheet
 
Product Number ARP81924_P050
Product Page www.avivasysbio.com/gfra3-antibody-middle-region-arp81924-p050.html
Name GFRA3 Antibody - middle region (ARP81924_P050)
Protein Size (# AA) 400 amino acids
Molecular Weight 44 kDa
NCBI Gene Id 2676
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name GDNF family receptor alpha 3
Alias Symbols GDNFR3
Peptide Sequence Synthetic peptide located within the following region: CLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor and a member of the GDNF receptor family. It forms a signaling receptor complex with RET tyrosine kinase receptor and binds the ligand, artemin.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GFRA3 (ARP81924_P050) antibody
Blocking Peptide For anti-GFRA3 (ARP81924_P050) antibody is Catalog # AAP81924
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GFRA3
Uniprot ID O60609
Protein Name GDNF family receptor alpha-3
Protein Accession # NP_001487.2
Purification Affinity purified
Nucleotide Accession # NM_001496.3
Tested Species Reactivity Human
Gene Symbol GFRA3
Predicted Species Reactivity Human
Application WB
Image 1
Human DLD1 Whole Cell
Host: Rabbit
Target Name: GFRA3
Sample Tissue: Human DLD1 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com