| Product Number |
ARP81884_P050 |
| Product Page |
www.avivasysbio.com/tagln2-antibody-middle-region-arp81884-p050.html |
| Name |
TAGLN2 Antibody - middle region (ARP81884_P050) |
| Protein Size (# AA) |
220 amino acids |
| Molecular Weight |
24 kDa |
| NCBI Gene Id |
8407 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
transgelin 2 |
| Alias Symbols |
HA1756 |
| Peptide Sequence |
Synthetic peptide located within the following region: NWFPKKSKENPRNFSDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TAGLN2 (ARP81884_P050) antibody |
| Blocking Peptide |
For anti-TAGLN2 (ARP81884_P050) antibody is Catalog # AAP81884 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle terminal region of human TAGLN2 |
| Uniprot ID |
P37802-2 |
| Protein Name |
transgelin-2 |
| Protein Accession # |
NP_001264152.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001277223.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TAGLN2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: TAGLN2
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
