EHD3 Antibody - N-terminal region (ARP81688_P050)

• Product Number: ARP81688_P050
• Name: EHD3 Antibody - N-terminal region (ARP81688_P050)
• Protein Size (# AA): 535 amino acids
• Molecular Weight: 58 kDa
• NCBI Gene Id: 30845
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: EH domain containing 3
• Alias Symbols: PAST3
• Peptide Sequence: Synthetic peptide located within the following region: FSWLGTDDRRRKDPEVFQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: ATP- and membrane-binding protein that controls membrane reorganization/tubulation upon ATP hydrolysis. In vitro causes tubulation of endocytic membranes. Binding to phosphatidic acid induces its membrane tubulation activity. Plays a role in endocytic transport. Involved in early endosome to recycling endosome compartment (ERC), retrograde early endosome to Golgi, and endosome to plasma membrane (rapid recycling) protein transport. Involved in the regulation of Golgi maintenance and morphology. Involved in the recycling of internalized D1 dopamine receptor. Plays a role in cardiac protein trafficking probably implicating ANK. Involved in the ventricular membrane targeting of SLC8A1 and CACNA1C and probably the atrial membrane localization of CACNA1GG and CACNA1H implicated in the regulation of atrial myocyte excitability and cardiac conduction. In conjunction with EHD4 may be involved in endocytic trafficking of KDR/VEGFR2 implicated in control of glomerular function. Involved in the rapid recycling of integrin beta-3 implicated in cell adhesion maintenance. Involved in the unidirectional retrograde dendritic transport of endocytosed BACE1 and in efficient sorting of BACE1 to axons implicating a function in neuronal APP processing. Plays a role in the formation of the ciliary vesicle, an early step in cilium biogenesis; possibly sharing redundant functions with EHD1.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-EHD3 (ARP81688_P050) antibody is Catalog # AAP81688
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EHD3
• Uniprot ID: Q9NZN3
• Protein Name: EH domain-containing protein 3
• Protein Accession #: NP_055415.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_014600.2
• Tested Species Reactivity: Human
• Gene Symbol: EHD3
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: EHD3
  Sample Tissue: Human Jurkat Whole Cell lysates
  Antibody Dilution: 1ug/ml