| Product Number |
ARP81311_P050 |
| Product Page |
www.avivasysbio.com/rassf2-antibody-middle-region-arp81311-p050.html |
| Name |
RASSF2 Antibody - middle region (ARP81311_P050) |
| Protein Size (# AA) |
326 amino acids |
| Molecular Weight |
38 kDa |
| NCBI Gene Id |
9770 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ras association domain family member 2 |
| Alias Symbols |
CENP-34, RASFADIN |
| Peptide Sequence |
Synthetic peptide located within the following region: SWGLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RASSF2 (ARP81311_P050) antibody |
| Blocking Peptide |
For anti-RASSF2 (ARP81311_P050) antibody is Catalog # AAP81311 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RASSF2 |
| Uniprot ID |
P50749 |
| Protein Name |
ras association domain-containing protein 2 |
| Protein Accession # |
NP_055552.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_014737.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RASSF2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Mesenchymoma Tumor
 | Host: Rabbit
Target Name: RASSF2
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
