KIR2DS4 Antibody - N-terminal region (ARP81226_P050)

Data Sheet
 
Product Number ARP81226_P050
Product Page www.avivasysbio.com/kir2ds4-antibody-n-terminal-region-arp81226-p050.html
Name KIR2DS4 Antibody - N-terminal region (ARP81226_P050)
Protein Size (# AA) 304 amino acids
Molecular Weight 33 kDa
NCBI Gene Id 3809
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 4
Alias Symbols KKA3, KIR1D, NKAT8, CD158I, KIR412, NKAT-8, KIR-2DS4
Peptide Sequence Synthetic peptide located within the following region: FLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHRE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KIR2DS4 (ARP81226_P050) antibody
Blocking Peptide For anti-KIR2DS4 (ARP81226_P050) antibody is Catalog # AAP81226
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KIR2DS4
Uniprot ID P43632
Protein Name killer cell immunoglobulin-like receptor 2DS4
Protein Accession # NP_001268900.1
Purification Affinity purified
Nucleotide Accession # NM_001281971.1
Tested Species Reactivity Human
Gene Symbol KIR2DS4
Predicted Species Reactivity Human
Application WB
Image 1
Human Leiomyosarcoma Tumor
Host: Rabbit
Target Name: KIR2DS4
Sample Tissue: Human Leiomyosarcoma Tumor lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com