| Product Number |
ARP81177_P050 |
| Product Page |
www.avivasysbio.com/pla2g7-antibody-middle-region-arp81177-p050.html |
| Name |
PLA2G7 Antibody - middle region (ARP81177_P050) |
| Protein Size (# AA) |
441 amino acids |
| Molecular Weight |
50 kDa |
| NCBI Gene Id |
7941 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
phospholipase A2 group VII |
| Alias Symbols |
PAFAD, PAFAH, LP-PLA2, LDL-PLA2 |
| Peptide Sequence |
Synthetic peptide located within the following region: EYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PLA2G7 (ARP81177_P050) antibody |
| Blocking Peptide |
For anti-PLA2G7 (ARP81177_P050) antibody is Catalog # AAP81177 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PLA2G7 |
| Uniprot ID |
Q13093 |
| Protein Name |
platelet-activating factor acetylhydrolase |
| Protein Accession # |
NP_001161829.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001168357.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PLA2G7 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Lung Tumor
 | Host: Rabbit
Target Name: PLA2G7
Sample Tissue: Human Lung Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
