Product Number |
ARP81040_P050 |
Product Page |
www.avivasysbio.com/nqo2-antibody-n-terminal-region-arp81040-p050.html |
Name |
NQO2 Antibody - N-terminal region (ARP81040_P050) |
Protein Size (# AA) |
231 amino acids |
Molecular Weight |
25 kDa |
NCBI Gene Id |
4835 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
NAD(P)H dehydrogenase, quinone 2 |
Alias Symbols |
QR2, DHQV, DIA6, NMOR2 |
Peptide Sequence |
Synthetic peptide located within the following region: KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the thioredoxin family of enzymes. It is a cytosolic and ubiquitously expressed flavoprotein that catalyzes the two-electron reduction of quinone substrates and uses dihydronicotinamide riboside as a reducing coenzyme. Mutations in this gene have been associated with neurodegenerative diseases and several cancers. Alternative splicing results in multiple transcript variants. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NQO2 (ARP81040_P050) antibody |
Blocking Peptide |
For anti-NQO2 (ARP81040_P050) antibody is Catalog # AAP81040 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NQO2 |
Uniprot ID |
P16083 |
Protein Name |
ribosyldihydronicotinamide dehydrogenase [quinone] |
Protein Accession # |
NP_000895.2 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_000904.4 |
Tested Species Reactivity |
Human |
Gene Symbol |
NQO2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human HeLa Whole Cell
| Host: Rabbit Target Name: NQO2 Sample Tissue: Human HeLa Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|