NQO2 Antibody - N-terminal region (ARP81040_P050)

Data Sheet
 
Product Number ARP81040_P050
Product Page www.avivasysbio.com/nqo2-antibody-n-terminal-region-arp81040-p050.html
Name NQO2 Antibody - N-terminal region (ARP81040_P050)
Protein Size (# AA) 231 amino acids
Molecular Weight 25 kDa
NCBI Gene Id 4835
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name NAD(P)H dehydrogenase, quinone 2
Alias Symbols QR2, DHQV, DIA6, NMOR2
Peptide Sequence Synthetic peptide located within the following region: KKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the thioredoxin family of enzymes. It is a cytosolic and ubiquitously expressed flavoprotein that catalyzes the two-electron reduction of quinone substrates and uses dihydronicotinamide riboside as a reducing coenzyme. Mutations in this gene have been associated with neurodegenerative diseases and several cancers. Alternative splicing results in multiple transcript variants.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NQO2 (ARP81040_P050) antibody
Blocking Peptide For anti-NQO2 (ARP81040_P050) antibody is Catalog # AAP81040
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NQO2
Uniprot ID P16083
Protein Name ribosyldihydronicotinamide dehydrogenase [quinone]
Protein Accession # NP_000895.2
Purification Affinity purified
Nucleotide Accession # NM_000904.4
Tested Species Reactivity Human
Gene Symbol NQO2
Predicted Species Reactivity Human
Application WB
Image 1
Human HeLa Whole Cell
Host: Rabbit
Target Name: NQO2
Sample Tissue: Human HeLa Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com