PRKG1 Antibody - C-terminal region (ARP81037_P050)

• Product Number: ARP81037_P050
• Name: PRKG1 Antibody - C-terminal region (ARP81037_P050)
• Protein Size (# AA): 389 amino acids
• Molecular Weight: 42 kDa
• NCBI Gene Id: 5592
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: protein kinase, cGMP-dependent, type I
• Alias Symbols: PKG, cGK, AAT8, PKG1, cGK1, cGKI, cGK 1, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha
• Peptide Sequence: Synthetic peptide located within the following region: FNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Mammals have three different isoforms of cyclic GMP-dependent protein kinase (Ialpha, Ibeta, and II). These PRKG isoforms act as key mediators of the nitric oxide/cGMP signaling pathway and are important components of many signal transduction processes in diverse cell types. This PRKG1 gene on human chromosome 10 encodes the soluble Ialpha and Ibeta isoforms of PRKG by alternative transcript splicing. A separate gene on human chromosome 4, PRKG2, encodes the membrane-bound PRKG isoform II. The PRKG1 proteins play a central role in regulating cardiovascular and neuronal functions in addition to relaxing smooth muscle tone, preventing platelet aggregation, and modulating cell growth. This gene is most strongly expressed in all types of smooth muscle, platelets, cerebellar Purkinje cells, hippocampal neurons, and the lateral amygdala. Isoforms Ialpha and Ibeta have identical cGMP-binding and catalytic domains but differ in their leucine/isoleucine zipper and autoinhibitory sequences and therefore differ in their dimerization substrates and kinase enzyme activity.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PRKG1 (ARP81037_P050) antibody is Catalog # AAP81037
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRKG1
• Uniprot ID: Q13976-3
• Protein Name: cGMP-dependent protein kinase 1
• Protein Accession #: NP_001091982.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001098512.2
• Tested Species Reactivity: Human
• Gene Symbol: PRKG1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human 786-0 Whole Cell
  
  Host: Rabbit
  Target Name: PRKG1
  Sample Tissue: Human 786-0 Whole Cell lysates
  Antibody Dilution: 1ug/ml