CTSA Antibody - N-terminal region (ARP80794_P050)

• Product Number: ARP80794_P050
• Name: CTSA Antibody - N-terminal region (ARP80794_P050)
• Protein Size (# AA): 480 amino acids
• Molecular Weight: 54 kDa
• NCBI Gene Id: 5476
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: cathepsin A
• Alias Symbols: GSL, GLB2, NGBE, PPCA, PPGB
• Peptide Sequence: Synthetic peptide located within the following region: DQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the peptidase S10 family of serine carboxypeptidases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate two chains that comprise the heterodimeric active enzyme. This enzyme possesses deamidase, esterase and carboxypeptidase activities and acts as a scaffold in the lysosomal multienzyme complex. Mutations in this gene are associated with galactosialidosis.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CTSA (ARP80794_P050) antibody is Catalog # AAP80794
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CTSA
• Uniprot ID: P10619
• Protein Name: Lysosomal protective protein
• Protein Accession #: NP_000299.2
• Purification: Affinity purified
• Nucleotide Accession #: NM_000308.3
• Tested Species Reactivity: Human
• Gene Symbol: CTSA
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Leiomyosarcoma Tumor
  
  Host: Rabbit
  Target Name: CTSA
  Sample Tissue: Human Leiomyosarcoma Tumor lysates
  Antibody Dilution: 1ug/ml