CTSA Antibody - N-terminal region (ARP80794_P050)

Data Sheet
 
Product Number ARP80794_P050
Product Page www.avivasysbio.com/ctsa-antibody-n-terminal-region-arp80794-p050.html
Product Name CTSA Antibody - N-terminal region (ARP80794_P050)
Size 100 ul
Gene Symbol CTSA
Alias Symbols GSL, GLB2, NGBE, PPCA, PPGB
Protein Size (# AA) 480 amino acids
Molecular Weight 54 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 5476
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name cathepsin A
Peptide Sequence Synthetic peptide located within the following region: DQDEIQRLPGLAKQPSFRQYSGYLKGSGSKHLHYWFVESQKDPENSPVVL
Description of Target This gene encodes a member of the peptidase S10 family of serine carboxypeptidases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate two chains that comprise the heterodimeric active enzyme. This enzyme possesses deamidase, esterase and carboxypeptidase activities and acts as a scaffold in the lysosomal multienzyme complex. Mutations in this gene are associated with galactosialidosis.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-CTSA (ARP80794_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-CTSA (ARP80794_P050) antibody is Catalog # AAP80794
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CTSA
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CTSA.
Swissprot Id P10619
Protein Name Lysosomal protective protein
Protein Accession # NP_000299.2
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CTSA.
Nucleotide Accession # NM_000308.3
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Image 1
Human Leiomyosarcoma Tumor
Host: Rabbit
Target Name: CTSA
Sample Tissue: Human Leiomyosarcoma Tumor lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com