PRLR Antibody - C-terminal region (ARP80729_P050)

• Product Number: ARP80729_P050
• Name: PRLR Antibody - C-terminal region (ARP80729_P050)
• Protein Size (# AA): 622 amino acids
• Molecular Weight: 68 kDa
• NCBI Gene Id: 5618
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: prolactin receptor
• Alias Symbols: HPRL, MFAB, hPRLrI, RI-PRLR
• Peptide Sequence: Synthetic peptide located within the following region: DGALSLLPKQRENSGKPKKPGTPENNKEYAKVSGVMDNNILVLVPDPHAK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a receptor for the anterior pituitary hormone, prolactin, and belongs to the type I cytokine receptor family. Prolactin-dependent signaling occurs as the result of ligand-induced dimerization of the prolactin receptor. Several alternatively spliced transcript variants encoding different membrane-bound and soluble isoforms have been described for this gene, which may function to modulate the endocrine and autocrine effects of prolactin in normal tissue and cancer.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PRLR (ARP80729_P050) antibody is Catalog # AAP80729
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRLR
• Uniprot ID: P16471
• Protein Name: prolactin receptor
• Protein Accession #: NP_000940.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_000949.6
• Tested Species Reactivity: Human
• Gene Symbol: PRLR
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: PRLR
  Sample Tissue: Human Jurkat Whole Cell lysates
  Antibody Dilution: 1ug/ml