IL12B Antibody - middle region (ARP80710_P050)

• Product Number: ARP80710_P050
• Name: IL12B Antibody - middle region (ARP80710_P050)
• Protein Size (# AA): 328 amino acids
• Molecular Weight: 36 kDa
• NCBI Gene Id: 3593
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: interleukin 12B
• Alias Symbols: CLMF, NKSF, CLMF2, IMD28, IMD29, NKSF2, IL-12B
• Peptide Sequence: Synthetic peptide located within the following region: IKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-IL12B (ARP80710_P050) antibody is Catalog # AAP80710
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL12B
• Uniprot ID: P29460
• Protein Name: interleukin-12 subunit beta
• Protein Accession #: NP_002178.2
• Purification: Affinity purified
• Nucleotide Accession #: NM_002187.2
• Tested Species Reactivity: Human
• Gene Symbol: IL12B
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human DLD1 Whole Cell
  
  Host: Rabbit
  Target Name: IL12B
  Sample Tissue: Human DLD1 Whole Cell lysates
  Antibody Dilution: 1ug/ml
• Image 2: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: IL12B
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 3ug/ml
• Image 3: Human HCT116 Whole Cell
  
  Host: Rabbit
  Target Name: IL12B
  Sample Tissue: Human HCT116 Whole Cell
  Antibody Dilution: 3ug/ml
• Image 4: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: IL12B
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 3ug/ml
• Image 5: Human A549 Whole Cell
  
  Host: Rabbit
  Target Name: IL12B
  Sample Tissue: Human A549 Whole Cell
  Antibody Dilution: 0.5ug/ml