| Product Number |
ARP80700_P050 |
| Product Page |
www.avivasysbio.com/hla-dqa1-antibody-middle-region-arp80700-p050.html |
| Name |
HLA-DQA1 Antibody - middle region (ARP80700_P050) |
| Protein Size (# AA) |
254 amino acids |
| Molecular Weight |
27 kDa |
| NCBI Gene Id |
3117 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
major histocompatibility complex, class II, DQ alpha 1 |
| Alias Symbols |
DQA1, DQ-A1, CELIAC1, HLA-DQA |
| Peptide Sequence |
Synthetic peptide located within the following region: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HLA-DQA1 (ARP80700_P050) antibody |
| Blocking Peptide |
For anti-HLA-DQA1 (ARP80700_P050) antibody is Catalog # AAP80700 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HLA-DQA1 |
| Uniprot ID |
P01909 |
| Protein Name |
HLA class II histocompatibility antigen, DQ alpha 1 chain |
| Protein Accession # |
NP_002113.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_002122.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HLA-DQA1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Mesenchymoma Tumor
 | Host: Rabbit
Target Name: HLA-DQA1
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
