Product Number |
ARP80536_P050 |
Product Page |
www.avivasysbio.com/cpz-antibody-middle-region-arp80536-p050.html |
Name |
CPZ Antibody - middle region (ARP80536_P050) |
Protein Size (# AA) |
515 amino acids |
Molecular Weight |
56 kDa |
NCBI Gene Id |
8532 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
carboxypeptidase Z |
Peptide Sequence |
Synthetic peptide located within the following region: AAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
This gene encodes a member of the metallocarboxypeptidase family. This enzyme displays carboxypeptidase activity towards substrates with basic C-terminal residues. It is most active at neutral pH and is inhibited by active site-directed inhibitors of metallocarboxypeptidases. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CPZ (ARP80536_P050) antibody |
Blocking Peptide |
For anti-CPZ (ARP80536_P050) antibody is Catalog # AAP80536 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CPZ |
Uniprot ID |
Q66K79-3 |
Protein Name |
carboxypeptidase Z |
Protein Accession # |
NP_001014447.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001014447.2 |
Tested Species Reactivity |
Human |
Gene Symbol |
CPZ |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: CPZ Sample Tissue: Human 786-0 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|