CPZ Antibody - middle region (ARP80536_P050)

Data Sheet
 
Product Number ARP80536_P050
Product Page www.avivasysbio.com/cpz-antibody-middle-region-arp80536-p050.html
Name CPZ Antibody - middle region (ARP80536_P050)
Protein Size (# AA) 515 amino acids
Molecular Weight 56 kDa
NCBI Gene Id 8532
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name carboxypeptidase Z
Peptide Sequence Synthetic peptide located within the following region: AAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target This gene encodes a member of the metallocarboxypeptidase family. This enzyme displays carboxypeptidase activity towards substrates with basic C-terminal residues. It is most active at neutral pH and is inhibited by active site-directed inhibitors of metallocarboxypeptidases. Alternative splicing in the coding region results in multiple transcript variants encoding different isoforms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CPZ (ARP80536_P050) antibody
Blocking Peptide For anti-CPZ (ARP80536_P050) antibody is Catalog # AAP80536
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CPZ
Uniprot ID Q66K79-3
Protein Name carboxypeptidase Z
Protein Accession # NP_001014447.1
Purification Affinity purified
Nucleotide Accession # NM_001014447.2
Tested Species Reactivity Human
Gene Symbol CPZ
Predicted Species Reactivity Human
Application WB
Image 1
Human 786-0 Whole Cell
Host: Rabbit
Target Name: CPZ
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com