| Product Number |
ARP80440_P050 |
| Product Page |
www.avivasysbio.com/atp1a2-antibody-n-terminal-region-arp80440-p050.html |
| Name |
ATP1A2 Antibody - N-terminal region (ARP80440_P050) |
| Protein Size (# AA) |
1020 amino acids |
| Molecular Weight |
112 kDa |
| NCBI Gene Id |
477 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATPase, Na+/K+ transporting, alpha 2 polypeptide |
| Alias Symbols |
FHM2, MHP2 |
| Peptide Sequence |
Synthetic peptide located within the following region: REYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 2 subunit. Mutations in this gene result in familial basilar or hemiplegic migraines, and in a rare syndrome known as alternating hemiplegia of childhood. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-ATP1A2 (ARP80440_P050) antibody |
| Blocking Peptide |
For anti-ATP1A2 (ARP80440_P050) antibody is Catalog # AAP80440 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP1A2 |
| Uniprot ID |
P50993 |
| Protein Name |
sodium/potassium-transporting ATPase subunit alpha-2 |
| Protein Accession # |
NP_000693.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_000702.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ATP1A2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Mesenchymoma Tumor
 | Host: Rabbit
Target Name: ATP1A2
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
