ZWILCH Antibody - middle region (ARP79885_P050)

Data Sheet
 
Product Number ARP79885_P050
Product Page www.avivasysbio.com/zwilch-antibody-middle-region-arp79885-p050.html
Name ZWILCH Antibody - middle region (ARP79885_P050)
Protein Size (# AA) 591 amino acids
Molecular Weight 65 kDa
NCBI Gene Id 55055
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name zwilch kinetochore protein
Alias Symbols KNTC1AP, hZwilch
Peptide Sequence Synthetic peptide located within the following region: IQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZWILCH (ARP79885_P050) antibody
Blocking Peptide For anti-ZWILCH (ARP79885_P050) antibody is Catalog # AAP79885
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ZWILCH
Uniprot ID Q9H900
Protein Name protein zwilch homolog
Protein Accession # NP_001274750.1
Purification Affinity purified
Nucleotide Accession # NM_001287821.1
Tested Species Reactivity Human
Gene Symbol ZWILCH
Predicted Species Reactivity Human
Application WB
Image 1
Human HCT116 Whole Cell
Host: Rabbit
Target Name: ZWILCH
Sample Tissue: Human HCT116 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com