Product Number |
ARP79708_P050 |
Product Page |
www.avivasysbio.com/capn6-antibody-middle-region-arp79708-p050.html |
Name |
CAPN6 Antibody - middle region (ARP79708_P050) |
Protein Size (# AA) |
641 amino acids |
Molecular Weight |
75 kDa |
NCBI Gene Id |
827 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
calpain 6 |
Alias Symbols |
CANPX, CAPNX, CalpM, DJ914P14.1 |
Peptide Sequence |
Synthetic peptide located within the following region: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to the calmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to be proteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promoting angiogenesis. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CAPN6 (ARP79708_P050) antibody |
Blocking Peptide |
For anti-CAPN6 (ARP79708_P050) antibody is Catalog # AAP79708 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CAPN6 |
Uniprot ID |
Q9Y6Q1 |
Protein Name |
calpain-6 |
Protein Accession # |
NP_055104.2 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_014289.3 |
Tested Species Reactivity |
Human |
Gene Symbol |
CAPN6 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human A172 Whole Cell
| Host: Rabbit Target Name: CAPN6 Sample Tissue: Human A172 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|