CAPN6 Antibody - middle region (ARP79708_P050)

Data Sheet
 
Product Number ARP79708_P050
Product Page www.avivasysbio.com/capn6-antibody-middle-region-arp79708-p050.html
Name CAPN6 Antibody - middle region (ARP79708_P050)
Protein Size (# AA) 641 amino acids
Molecular Weight 75 kDa
NCBI Gene Id 827
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name calpain 6
Alias Symbols CANPX, CAPNX, CalpM, DJ914P14.1
Peptide Sequence Synthetic peptide located within the following region: TIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is highly expressed in the placenta. Its C-terminal region lacks any homology to the calmodulin-like domain of other calpains. The protein lacks critical active site residues and thus is suggested to be proteolytically inactive. The protein may play a role in tumor formation by inhibiting apoptosis and promoting angiogenesis.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CAPN6 (ARP79708_P050) antibody
Blocking Peptide For anti-CAPN6 (ARP79708_P050) antibody is Catalog # AAP79708
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CAPN6
Uniprot ID Q9Y6Q1
Protein Name calpain-6
Protein Accession # NP_055104.2
Purification Affinity purified
Nucleotide Accession # NM_014289.3
Tested Species Reactivity Human
Gene Symbol CAPN6
Predicted Species Reactivity Human
Application WB
Image 1
Human A172 Whole Cell
Host: Rabbit
Target Name: CAPN6
Sample Tissue: Human A172 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com