USH1C Antibody - middle region (ARP79327_P050)

• Product Number: ARP79327_P050
• Name: USH1C Antibody - middle region (ARP79327_P050)
• Protein Size (# AA): 552 amino acids
• Molecular Weight: 60 kDa
• NCBI Gene Id: 10083
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Usher syndrome 1C
• Alias Symbols: PDZ73, AIE-75, DFNB18, PDZ-45, PDZ-73, PDZD7C, DFNB18A, NY-CO-37, NY-CO-38, ush1cpst, PDZ-73/NY-CO-38
• Peptide Sequence: Synthetic peptide located within the following region: NERYRKEMEQIVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a scaffold protein that functions in the assembly of Usher protein complexes. The protein contains PDZ domains, a coiled-coil region with a bipartite nuclear localization signal and a PEST degradation sequence. Defects in this gene are the cause of Usher syndrome type 1C and non-syndromic sensorineural deafness autosomal recessive type 18. Multiple transcript variants encoding different isoforms have been found for this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-USH1C (ARP79327_P050) antibody is Catalog # AAP79327
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human USH1C
• Uniprot ID: Q9Y6N9
• Protein Name: harmonin
• Protein Accession #: NP_001284693.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001297764.1
• Tested Species Reactivity: Human
• Gene Symbol: USH1C
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Du145 Whole Cell
  
  Host: Rabbit
  Target Name: USH1C
  Sample Tissue: Human Du145 Whole Cell lysates
  Antibody Dilution: 1ug/ml