| Product Number |
ARP79173_P050 |
| Product Page |
www.avivasysbio.com/c2-antibody-middle-region-arp79173-p050.html |
| Name |
C2 Antibody - middle region (ARP79173_P050) |
| Protein Size (# AA) |
353 amino acids |
| Molecular Weight |
38 kDa |
| NCBI Gene Id |
717 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
complement component 2 |
| Alias Symbols |
CO2, ARMD14 |
| Peptide Sequence |
Synthetic peptide located within the following region: FILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVTIKP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Component C2 is a serum glycoprotein that functions as part of the classical pathway of the complement system. Activated C1 cleaves C2 into C2a and C2b. The serine proteinase C2a then combines with complement factor 4b to create the C3 or C5 convertase. Deficiency of C2 has been reported to associated with certain autoimmune diseases and SNPs in this gene have been associated with altered susceptibility to age-related macular degeneration. This gene localizes within the class III region of the MHC on the short arm of chromosome 6. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described in publications but their full-length sequence has not been determined. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-C2 (ARP79173_P050) antibody |
| Blocking Peptide |
For anti-C2 (ARP79173_P050) antibody is Catalog # AAP79173 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C2 |
| Uniprot ID |
A0A0G2JK28 |
| Protein Name |
complement C2 |
| Protein Accession # |
NP_000054.2 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
C2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: C2
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
