| Product Number |
ARP79162_P050 |
| Product Page |
www.avivasysbio.com/rgs12-antibody-middle-region-arp79162-p050.html |
| Name |
RGS12 Antibody - middle region (ARP79162_P050) |
| Protein Size (# AA) |
667 amino acids |
| Molecular Weight |
73 kDa |
| NCBI Gene Id |
6002 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
regulator of G-protein signaling 12 |
| Peptide Sequence |
Synthetic peptide located within the following region: WQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a member of the 'regulator of G protein signaling' (RGS) gene family. The encoded protein may function as a guanosine triphosphatase (GTPase)-activating protein as well as a transcriptional repressor. This protein may play a role in tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their biological nature has not been determined. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RGS12 (ARP79162_P050) antibody |
| Blocking Peptide |
For anti-RGS12 (ARP79162_P050) antibody is Catalog # AAP79162 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RGS12 |
| Uniprot ID |
E9PBG5 |
| Protein Name |
regulator of G-protein signaling 12 |
| Protein Accession # |
NP_002917.1 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RGS12 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Ovary Tumor
 | Host: Rabbit
Target Name: RGS12
Sample Tissue: Human Ovary Tumor lysates
Antibody Dilution: 1ug/ml |
|
|
