Product Number |
ARP78925_P050 |
Product Page |
www.avivasysbio.com/ndel1-antibody-c-terminal-region-arp78925-p050.html |
Name |
NDEL1 Antibody - C-terminal region (ARP78925_P050) |
Protein Size (# AA) |
345 amino acids |
Molecular Weight |
38 kDa |
NCBI Gene Id |
81565 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
nudE neurodevelopment protein 1 like 1 |
Alias Symbols |
EOPA, NDE2, NUDEL, MITAP1, NDE1L1 |
Peptide Sequence |
Synthetic peptide located within the following region: VLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts (By similarity). |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NDEL1 (ARP78925_P050) antibody |
Blocking Peptide |
For anti-NDEL1 (ARP78925_P050) antibody is Catalog # AAP78925 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NDEL1 |
Uniprot ID |
Q9GZM8 |
Protein Name |
nuclear distribution protein nudE-like 1 |
Protein Accession # |
NP_001020750.1 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001025579.2 |
Tested Species Reactivity |
Human |
Gene Symbol |
NDEL1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human A172 Whole Cell
| Host: Rabbit Target Name: NDEL1 Sample Tissue: Human A172 Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|