NDEL1 Antibody - C-terminal region (ARP78925_P050)

Data Sheet
 
Product Number ARP78925_P050
Product Page www.avivasysbio.com/ndel1-antibody-c-terminal-region-arp78925-p050.html
Name NDEL1 Antibody - C-terminal region (ARP78925_P050)
Protein Size (# AA) 345 amino acids
Molecular Weight 38 kDa
NCBI Gene Id 81565
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name nudE neurodevelopment protein 1 like 1
Alias Symbols EOPA, NDE2, NUDEL, MITAP1, NDE1L1
Peptide Sequence Synthetic peptide located within the following region: VLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts (By similarity).
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NDEL1 (ARP78925_P050) antibody
Blocking Peptide For anti-NDEL1 (ARP78925_P050) antibody is Catalog # AAP78925
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NDEL1
Uniprot ID Q9GZM8
Protein Name nuclear distribution protein nudE-like 1
Protein Accession # NP_001020750.1
Purification Affinity purified
Nucleotide Accession # NM_001025579.2
Tested Species Reactivity Human
Gene Symbol NDEL1
Predicted Species Reactivity Human
Application WB
Image 1
Human A172 Whole Cell
Host: Rabbit
Target Name: NDEL1
Sample Tissue: Human A172 Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com