Product Number |
ARP78902_P050 |
Product Page |
www.avivasysbio.com/arhgef10l-antibody-c-terminal-region-arp78902-p050.html |
Name |
ARHGEF10L Antibody - C-terminal region (ARP78902_P050) |
Protein Size (# AA) |
1279 amino acids |
Molecular Weight |
141 kDa |
NCBI Gene Id |
55160 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Rho guanine nucleotide exchange factor 10 like |
Alias Symbols |
GrinchGEF |
Peptide Sequence |
Synthetic peptide located within the following region: SILAPDILRSDQEEAEGPRAEEDKPDGQAHEPMPDSHVGRELTRKKGILL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
ARHGEF10L is a member of the RhoGEF family of guanine nucleotide exchange factors (GEFs) that activate Rho GTPases (Winkler et al., 2005 [PubMed 16112081]).[supplied by OMIM, Dec 2008] |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ARHGEF10L (ARP78902_P050) antibody |
Blocking Peptide |
For anti-ARHGEF10L (ARP78902_P050) antibody is Catalog # AAP78902 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGEF10L |
Uniprot ID |
Q9HCE6 |
Protein Name |
rho guanine nucleotide exchange factor 10-like protein |
Protein Accession # |
NP_001011722.2 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_001011722.2 |
Tested Species Reactivity |
Human |
Gene Symbol |
ARHGEF10L |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human 293T Whole Cell
| Host: Rabbit Target Name: ARHGEF10L Sample Tissue: 293T Whole Cell lysates Antibody Dilution: 1ug/ml |
|
|