ARHGEF10L Antibody - C-terminal region (ARP78902_P050)

Data Sheet
 
Product Number ARP78902_P050
Product Page www.avivasysbio.com/arhgef10l-antibody-c-terminal-region-arp78902-p050.html
Name ARHGEF10L Antibody - C-terminal region (ARP78902_P050)
Protein Size (# AA) 1279 amino acids
Molecular Weight 141 kDa
NCBI Gene Id 55160
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Rho guanine nucleotide exchange factor 10 like
Alias Symbols GrinchGEF
Peptide Sequence Synthetic peptide located within the following region: SILAPDILRSDQEEAEGPRAEEDKPDGQAHEPMPDSHVGRELTRKKGILL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target ARHGEF10L is a member of the RhoGEF family of guanine nucleotide exchange factors (GEFs) that activate Rho GTPases (Winkler et al., 2005 [PubMed 16112081]).[supplied by OMIM, Dec 2008]
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ARHGEF10L (ARP78902_P050) antibody
Blocking Peptide For anti-ARHGEF10L (ARP78902_P050) antibody is Catalog # AAP78902
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGEF10L
Uniprot ID Q9HCE6
Protein Name rho guanine nucleotide exchange factor 10-like protein
Protein Accession # NP_001011722.2
Purification Affinity purified
Nucleotide Accession # NM_001011722.2
Tested Species Reactivity Human
Gene Symbol ARHGEF10L
Predicted Species Reactivity Human
Application WB
Image 1
Human 293T Whole Cell
Host: Rabbit
Target Name: ARHGEF10L
Sample Tissue: 293T Whole Cell lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com