DNTTIP2 Antibody - C-terminal region (ARP78708_P050)

• Product Number: ARP78708_P050
• Name: DNTTIP2 Antibody - C-terminal region (ARP78708_P050)
• Protein Size (# AA): 756 amino acids
• Molecular Weight: 83 kDa
• NCBI Gene Id: 30836
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: deoxynucleotidyltransferase, terminal, interacting protein 2
• Alias Symbols: ERBP, FCF2, TdIF2, HSU15552, LPTS-RP2
• Peptide Sequence: Synthetic peptide located within the following region: EMTNELKNDLKALKMRASMDPKRFYKKNDRDGFPKYFQIGTIVDNPADFY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene is thought to be involved in chromatin remodeling and gene transcription. The encoded nuclear protein binds to and enhances the transcriptional activity of the estrogen receptor alpha, and also interacts with terminal deoxynucleotidyltransferase. The expression profile of this gene is a potential biomarker for chronic obstructive pulmonary disease.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DNTTIP2 (ARP78708_P050) antibody is Catalog # AAP78708
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DNTTIP2
• Uniprot ID: Q5QJE6
• Protein Name: deoxynucleotidyltransferase terminal-interacting protein 2
• Protein Accession #: NP_055412.2
• Purification: Affinity purified
• Nucleotide Accession #: NM_014597.4
• Tested Species Reactivity: Human
• Gene Symbol: DNTTIP2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human 293T Whole Cell
  
  Host: Rabbit
  Target Name: DNTTIP2
  Sample Tissue: Human 293T Whole Cell lysates
  Antibody Dilution: 1ug/ml