| Product Number |
ARP78509_P050 |
| Product Page |
www.avivasysbio.com/rcn2-antibody-middle-region-arp78509-p050.html |
| Name |
RCN2 Antibody - middle region (ARP78509_P050) |
| Protein Size (# AA) |
317 amino acids |
| Molecular Weight |
35 kDa |
| NCBI Gene Id |
5955 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
reticulocalbin 2 |
| Alias Symbols |
E6BP, ERC55, ERC-55, TCBP49 |
| Peptide Sequence |
Synthetic peptide located within the following region: RVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. This gene maps to the same region as type 4 Bardet-Biedl syndrome, suggesting a possible causative role for this gene in the disorder. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RCN2 (ARP78509_P050) antibody |
| Blocking Peptide |
For anti-RCN2 (ARP78509_P050) antibody is Catalog # AAP78509 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human RCN2 |
| Uniprot ID |
Q14257 |
| Protein Name |
reticulocalbin-2 |
| Protein Accession # |
NP_001258766.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001271837.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RCN2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human ACHN Whole Cell
 | Host: Rabbit
Target Name: RCN2
Sample Tissue: ACHN Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
