| Product Number |
ARP78297_P050 |
| Product Page |
www.avivasysbio.com/aldh1a3-antibody-middle-region-arp78297-p050.html |
| Name |
ALDH1A3 Antibody - middle region (ARP78297_P050) |
| Protein Size (# AA) |
512 amino acids |
| Molecular Weight |
56 kDa |
| NCBI Gene Id |
220 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
aldehyde dehydrogenase 1 family member A3 |
| Alias Symbols |
ALDH6, MCOP8, RALDH3, ALDH1A6 |
| Peptide Sequence |
Synthetic peptide located within the following region: RSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes an aldehyde dehydrogenase enzyme that uses retinal as a substrate. Mutations in this gene have been associated with microphthalmia, isolated 8, and expression changes have also been detected in tumor cells. Alternative splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALDH1A3 (ARP78297_P050) antibody |
| Blocking Peptide |
For anti-ALDH1A3 (ARP78297_P050) antibody is Catalog # AAP78297 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ALDH1A3 |
| Uniprot ID |
P47895 |
| Protein Name |
aldehyde dehydrogenase family 1 member A3 |
| Protein Accession # |
NP_000684.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_000693.3 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ALDH1A3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human ACHN Whole Cell
 | Host: Rabbit
Target Name: ALDH1A3
Sample Tissue: ACHN Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
