| Product Number |
ARP78221_P050 |
| Product Page |
www.avivasysbio.com/snapin-antibody-middle-region-arp78221-p050.html |
| Name |
SNAPIN Antibody - middle region (ARP78221_P050) |
| Protein Size (# AA) |
136 amino acids |
| Molecular Weight |
14 kDa |
| NCBI Gene Id |
23557 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SNAP associated protein |
| Alias Symbols |
BLOS7, BORCS3, SNAPAP, BLOC1S7 |
| Peptide Sequence |
Synthetic peptide located within the following region: LDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SNAPIN (ARP78221_P050) antibody |
| Blocking Peptide |
For anti-SNAPIN (ARP78221_P050) antibody is Catalog # AAP78221 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SNAPIN |
| Uniprot ID |
O95295 |
| Protein Name |
SNARE-associated protein Snapin |
| Protein Accession # |
NP_036569.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_012437.5 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SNAPIN |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human HCT15 Whole Cell
 | Host: Rabbit
Target Name: SNAPIN
Sample Tissue: HCT15 Whole Cell lysates
Antibody Dilution: 1.0ug/ml |
|
|
