Product Number |
ARP77732_P050 |
Product Page |
www.avivasysbio.com/wnt5b-antibody-middle-region-arp77732-p050.html |
Name |
WNT5B Antibody - middle region (ARP77732_P050) |
Protein Size (# AA) |
359 amino acids |
Molecular Weight |
39 kDa |
NCBI Gene Id |
81029 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
wingless-type MMTV integration site family member 5B |
Peptide Sequence |
Synthetic peptide located within the following region: PKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein, respectively. Alternative splicing of this gene generates 2 transcript variants. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-WNT5B (ARP77732_P050) antibody |
Blocking Peptide |
For anti-WNT5B (ARP77732_P050) antibody is Catalog # AAP77732 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human WNT5B |
Uniprot ID |
Q9H1J7 |
Protein Name |
protein Wnt-5b |
Protein Accession # |
NP_110402.2 |
Purification |
Affinity purified |
Nucleotide Accession # |
NM_030775.2 |
Tested Species Reactivity |
Human |
Gene Symbol |
WNT5B |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human U937 Whole Cell
| Host: Rabbit Target Name: WNT5B Sample Tissue: U937 Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|
|