LCP1 Antibody - C-terminal region (ARP76347_P050)

Data Sheet
 
Product Number ARP76347_P050
Product Page www.avivasysbio.com/lcp1-antibody-c-terminal-region-arp76347-p050.html
Name LCP1 Antibody - C-terminal region (ARP76347_P050)
Protein Size (# AA) 627 amino acids
Molecular Weight 68 kDa
NCBI Gene Id 3936
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name lymphocyte cytosolic protein 1 (L-plastin)
Alias Symbols LPL, CP64, PLS2, LC64P, HEL-S-37, L-PLASTIN
Peptide Sequence Synthetic peptide located within the following region: DPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference N/A
Description of Target Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LCP1 (ARP76347_P050) antibody
Blocking Peptide For Anti-LCP1 antibody is Catalog # AAP76347
Immunogen The immunogen for Anti-LCP1 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSL
Uniprot ID P13796
Protein Accession # XP_005266431.1
Purification Affinity purified
Tested Species Reactivity Human
Gene Symbol LCP1
Predicted Species Reactivity Human
Application WB
Image 1
Human Jurkat Whole Cell
WB Suggested Anti-PLSL antibody Titration: 1 ug/mL
Sample Type: Human Jurkat Whole Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com