Product Number |
ARP76347_P050 |
Product Page |
www.avivasysbio.com/lcp1-antibody-c-terminal-region-arp76347-p050.html |
Name |
LCP1 Antibody - C-terminal region (ARP76347_P050) |
Protein Size (# AA) |
627 amino acids |
Molecular Weight |
68 kDa |
NCBI Gene Id |
3936 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
lymphocyte cytosolic protein 1 (L-plastin) |
Alias Symbols |
LPL, CP64, PLS2, LC64P, HEL-S-37, L-PLASTIN |
Peptide Sequence |
Synthetic peptide located within the following region: DPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
N/A |
Description of Target |
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LCP1 (ARP76347_P050) antibody |
Blocking Peptide |
For Anti-LCP1 antibody is Catalog # AAP76347 |
Immunogen |
The immunogen for Anti-LCP1 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSL |
Uniprot ID |
P13796 |
Protein Accession # |
XP_005266431.1 |
Purification |
Affinity purified |
Tested Species Reactivity |
Human |
Gene Symbol |
LCP1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human Jurkat Whole Cell
| WB Suggested Anti-PLSL antibody Titration: 1 ug/mL Sample Type: Human Jurkat Whole Cell |
|
|