Product Number |
ARP76236_P050-FITC |
Product Page |
www.avivasysbio.com/grpr-antibody-n-terminal-region-fitc-arp76236-p050-fitc.html |
Name |
GRPR Antibody - N-terminal region : FITC (ARP76236_P050-FITC) |
Protein Size (# AA) |
384 amino acids |
Molecular Weight |
43kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
2925 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
BB2, BB2R |
Peptide Sequence |
Synthetic peptide located within the following region: FLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-GRPR (ARP76236_P050-FITC) antibody |
Blocking Peptide |
For anti-GRPR (ARP76236_P050-FITC) antibody is Catalog # AAP76226 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GRPR |
Uniprot ID |
P30550 |
Protein Accession # |
NP_005305 |
Purification |
Affinity purified |
Gene Symbol |
GRPR |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|