GALNT2 Antibody - middle region : FITC (ARP76183_P050-FITC)

Data Sheet
 
Product Number ARP76183_P050-FITC
Product Page www.avivasysbio.com/galnt2-antibody-middle-region-fitc-arp76183-p050-fitc.html
Name GALNT2 Antibody - middle region : FITC (ARP76183_P050-FITC)
Protein Size (# AA) 571 amino acids
Molecular Weight 62kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 2590
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name polypeptide N-acetylgalactosaminyltransferase 2
Alias Symbols CDG2T, GalNAc-T2
Peptide Sequence Synthetic peptide located within the following region: IDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene encodes a member of the glycosyltransferase 2 protein family. Members of this family initiate mucin-type O-glycoslation of peptides in the Golgi apparatus. The encoded protein may be involved in O-linked glycosylation of the immunoglobulin A1 hinge region. This gene may influence triglyceride levels, and may be involved Type 2 diabetes, as well as several types of cancer. Alternative splicing results in multiple transcript variants.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-GALNT2 (ARP76183_P050-FITC) antibody
Blocking Peptide For anti-GALNT2 (ARP76183_P050-FITC) antibody is Catalog # AAP76183
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human GALT2
Uniprot ID Q10471
Protein Name polypeptide N-acetylgalactosaminyltransferase 2
Protein Accession # NP_004472
Purification Affinity purified
Gene Symbol GALNT2
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com