Product Number |
ARP76183_P050-FITC |
Product Page |
www.avivasysbio.com/galnt2-antibody-middle-region-fitc-arp76183-p050-fitc.html |
Name |
GALNT2 Antibody - middle region : FITC (ARP76183_P050-FITC) |
Protein Size (# AA) |
571 amino acids |
Molecular Weight |
62kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
2590 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
polypeptide N-acetylgalactosaminyltransferase 2 |
Alias Symbols |
CDG2T, GalNAc-T2 |
Peptide Sequence |
Synthetic peptide located within the following region: IDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
This gene encodes a member of the glycosyltransferase 2 protein family. Members of this family initiate mucin-type O-glycoslation of peptides in the Golgi apparatus. The encoded protein may be involved in O-linked glycosylation of the immunoglobulin A1 hinge region. This gene may influence triglyceride levels, and may be involved Type 2 diabetes, as well as several types of cancer. Alternative splicing results in multiple transcript variants. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-GALNT2 (ARP76183_P050-FITC) antibody |
Blocking Peptide |
For anti-GALNT2 (ARP76183_P050-FITC) antibody is Catalog # AAP76183 |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human GALT2 |
Uniprot ID |
Q10471 |
Protein Name |
polypeptide N-acetylgalactosaminyltransferase 2 |
Protein Accession # |
NP_004472 |
Purification |
Affinity purified |
Gene Symbol |
GALNT2 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|