Product Number |
ARP76171_P050-FITC |
Product Page |
www.avivasysbio.com/frg1-antibody-n-terminal-region-fitc-arp76171-p050-fitc.html |
Name |
FRG1 Antibody - N-terminal region : FITC (ARP76171_P050-FITC) |
Protein Size (# AA) |
258 amino acids |
Molecular Weight |
28kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
2483 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
FSG1, FRG1A |
Peptide Sequence |
Synthetic peptide located within the following region: GTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTVTNFGEISGTIAIEMD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
This gene maps to a location 100 kb centromeric of the repeat units on chromosome 4q35 which are deleted in facioscapulohumeral muscular dystrophy (FSHD). It is evolutionarily conserved and has related sequences on multiple human chromosomes but DNA sequence analysis did not reveal any homology to known genes. In vivo studies demonstrate the encoded protein is localized to the nucleolus. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-FRG1 (ARP76171_P050-FITC) antibody |
Blocking Peptide |
For anti-FRG1 (ARP76171_P050-FITC) antibody is Catalog # AAP76171 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FRG1 |
Uniprot ID |
Q14331 |
Protein Accession # |
NP_004468 |
Purification |
Affinity purified |
Gene Symbol |
FRG1 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|