Product Number |
ARP76144_P050 |
Product Page |
www.avivasysbio.com/fancg-antibody-c-terminal-region-arp76144-p050.html |
Name |
FANCG Antibody - C-terminal region (ARP76144_P050) |
Protein Size (# AA) |
622 amino acids |
Molecular Weight |
68kDa |
NCBI Gene Id |
2189 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
FAG, XRCC9 |
Peptide Sequence |
Synthetic peptide located within the following region: AEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
N/A |
Description of Target |
FANCG is a DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. It may be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. It is a candidate tumor suppressor gene. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FANCG (ARP76144_P050) antibody |
Blocking Peptide |
For anti-FANCG (ARP76144_P050) antibody is Catalog # AAP76144 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FANCG |
Uniprot ID |
O15287 |
Protein Accession # |
NP_004620 |
Purification |
Affinity purified |
Tested Species Reactivity |
Human |
Gene Symbol |
FANCG |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | Human HCT116 Whole Cell
| Host: Rabbit Target Name: FANCG Sample Type: HCT116 Whole Cell lysates Antibody Dilution: 1.0ug/ml |
|
|