FANCG Antibody - C-terminal region (ARP76144_P050)

Data Sheet
 
Product Number ARP76144_P050
Product Page www.avivasysbio.com/fancg-antibody-c-terminal-region-arp76144-p050.html
Name FANCG Antibody - C-terminal region (ARP76144_P050)
Protein Size (# AA) 622 amino acids
Molecular Weight 68kDa
NCBI Gene Id 2189
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols FAG, XRCC9
Peptide Sequence Synthetic peptide located within the following region: AEHYLDLLALLLDSSEPRFSPPPSPPGPCMPEVFLEAAVALIQAGRAQDA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference N/A
Description of Target FANCG is a DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. It may be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. It is a candidate tumor suppressor gene.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FANCG (ARP76144_P050) antibody
Blocking Peptide For anti-FANCG (ARP76144_P050) antibody is Catalog # AAP76144
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human FANCG
Uniprot ID O15287
Protein Accession # NP_004620
Purification Affinity purified
Tested Species Reactivity Human
Gene Symbol FANCG
Predicted Species Reactivity Human
Application WB
Image 1
Human HCT116 Whole Cell
Host: Rabbit
Target Name: FANCG
Sample Type: HCT116 Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com