ERF Antibody - C-terminal region : FITC (ARP76132_P050-FITC)

Data Sheet
 
Product Number ARP76132_P050-FITC
Product Page www.avivasysbio.com/erf-antibody-c-terminal-region-fitc-arp76132-p050-fitc.html
Name ERF Antibody - C-terminal region : FITC (ARP76132_P050-FITC)
Protein Size (# AA) 548 amino acids
Molecular Weight 60kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 2077
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols PE2, CRS4, PE-2, CHYTS
Peptide Sequence Synthetic peptide located within the following region: MPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target Members of the ETS family of transcription factors, such as ERF, regulate cell proliferation and differentiation. They share a highly conserved DNA-binding domain, the ETS domain, that recognizes the sequence GGAA/T (de Castro et al., 1997 [PubMed 9192842]). For further information on ETS transcription factors, see ETS1 (MIM 164720).
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-ERF (ARP76132_P050-FITC) antibody
Blocking Peptide For anti-ERF (ARP76132_P050-FITC) antibody is Catalog # AAP76132
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERF
Uniprot ID P50548
Purification Affinity purified
Gene Symbol ERF
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com