Product Number |
ARP76132_P050-FITC |
Product Page |
www.avivasysbio.com/erf-antibody-c-terminal-region-fitc-arp76132-p050-fitc.html |
Name |
ERF Antibody - C-terminal region : FITC (ARP76132_P050-FITC) |
Protein Size (# AA) |
548 amino acids |
Molecular Weight |
60kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
2077 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
PE2, CRS4, PE-2, CHYTS |
Peptide Sequence |
Synthetic peptide located within the following region: MPLKLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
Members of the ETS family of transcription factors, such as ERF, regulate cell proliferation and differentiation. They share a highly conserved DNA-binding domain, the ETS domain, that recognizes the sequence GGAA/T (de Castro et al., 1997 [PubMed 9192842]). For further information on ETS transcription factors, see ETS1 (MIM 164720). |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-ERF (ARP76132_P050-FITC) antibody |
Blocking Peptide |
For anti-ERF (ARP76132_P050-FITC) antibody is Catalog # AAP76132 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERF |
Uniprot ID |
P50548 |
Purification |
Affinity purified |
Gene Symbol |
ERF |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|