| Product Number |
ARP76127_P050-FITC |
| Product Page |
www.avivasysbio.com/epha5-antibody-n-terminal-region-fitc-arp76127-p050-fitc.html |
| Name |
EPHA5 Antibody - N-terminal region : FITC (ARP76127_P050-FITC) |
| Protein Size (# AA) |
1037 amino acids |
| Molecular Weight |
114kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
2044 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
EK7, CEK7, EHK1, HEK7, EHK-1, TYRO4 |
| Peptide Sequence |
Synthetic peptide located within the following region: IELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Description of Target |
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-EPHA5 (ARP76127_P050-FITC) antibody |
| Blocking Peptide |
For anti-EPHA5 (ARP76127_P050-FITC) antibody is Catalog # AAP76127 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EPHA5 |
| Uniprot ID |
P54756 |
| Purification |
Affinity purified |
| Gene Symbol |
EPHA5 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
