Product Number |
ARP76111_P050-FITC |
Product Page |
www.avivasysbio.com/efna3-antibody-n-terminal-region-fitc-arp76111-p050-fitc.html |
Name |
EFNA3 Antibody - N-terminal region : FITC (ARP76111_P050-FITC) |
Protein Size (# AA) |
238 amino acids |
Molecular Weight |
26kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
1944 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
EFL2, EPLG3, LERK3, Ehk1-L |
Peptide Sequence |
Synthetic peptide located within the following region: LLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-EFNA3 (ARP76111_P050-FITC) antibody |
Blocking Peptide |
For anti-EFNA3 (ARP76111_P050-FITC) antibody is Catalog # AAP76111 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human EFNA3 |
Uniprot ID |
P52797 |
Protein Accession # |
NP_004943 |
Purification |
Affinity purified |
Gene Symbol |
EFNA3 |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|