EFNA3 Antibody - N-terminal region : FITC (ARP76111_P050-FITC)

Data Sheet
 
Product Number ARP76111_P050-FITC
Product Page www.avivasysbio.com/efna3-antibody-n-terminal-region-fitc-arp76111-p050-fitc.html
Name EFNA3 Antibody - N-terminal region : FITC (ARP76111_P050-FITC)
Protein Size (# AA) 238 amino acids
Molecular Weight 26kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 1944
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols EFL2, EPLG3, LERK3, Ehk1-L
Peptide Sequence Synthetic peptide located within the following region: LLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-EFNA3 (ARP76111_P050-FITC) antibody
Blocking Peptide For anti-EFNA3 (ARP76111_P050-FITC) antibody is Catalog # AAP76111
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human EFNA3
Uniprot ID P52797
Protein Accession # NP_004943
Purification Affinity purified
Gene Symbol EFNA3
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com