Product Number |
ARP76106_P050-FITC |
Product Page |
www.avivasysbio.com/tymp-antibody-n-terminal-region-fitc-arp76106-p050-fitc.html |
Name |
TYMP Antibody - N-terminal region : FITC (ARP76106_P050-FITC) |
Protein Size (# AA) |
482 amino acids |
Molecular Weight |
53kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
1890 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
thymidine phosphorylase |
Alias Symbols |
TP, ECGF, ECGF1, MNGIE, MEDPS1, MTDPS1, PDECGF, hPD-ECGF |
Peptide Sequence |
Synthetic peptide located within the following region: GEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
This gene encodes an angiogenic factor which promotes angiogenesis in vivo and stimulates the in vitro growth of a variety of endothelial cells. It has a highly restricted target cell specificity acting only on endothelial cells. Mutations in this gene have been associated with mitochondrial neurogastrointestinal encephalomyopathy. Multiple alternatively spliced transcript variants have been identified. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-TYMP (ARP76106_P050-FITC) antibody |
Blocking Peptide |
For anti-TYMP (ARP76106_P050-FITC) antibody is Catalog # AAP76106 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TYPH |
Uniprot ID |
P19971 |
Protein Name |
thymidine phosphorylase |
Protein Accession # |
NP_001944 |
Purification |
Affinity purified |
Gene Symbol |
TYMP |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|