TYMP Antibody - N-terminal region : FITC (ARP76106_P050-FITC)

Data Sheet
 
Product Number ARP76106_P050-FITC
Product Page www.avivasysbio.com/tymp-antibody-n-terminal-region-fitc-arp76106-p050-fitc.html
Name TYMP Antibody - N-terminal region : FITC (ARP76106_P050-FITC)
Protein Size (# AA) 482 amino acids
Molecular Weight 53kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 1890
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name thymidine phosphorylase
Alias Symbols TP, ECGF, ECGF1, MNGIE, MEDPS1, MTDPS1, PDECGF, hPD-ECGF
Peptide Sequence Synthetic peptide located within the following region: GEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target This gene encodes an angiogenic factor which promotes angiogenesis in vivo and stimulates the in vitro growth of a variety of endothelial cells. It has a highly restricted target cell specificity acting only on endothelial cells. Mutations in this gene have been associated with mitochondrial neurogastrointestinal encephalomyopathy. Multiple alternatively spliced transcript variants have been identified.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-TYMP (ARP76106_P050-FITC) antibody
Blocking Peptide For anti-TYMP (ARP76106_P050-FITC) antibody is Catalog # AAP76106
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human TYPH
Uniprot ID P19971
Protein Name thymidine phosphorylase
Protein Accession # NP_001944
Purification Affinity purified
Gene Symbol TYMP
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com