CYP11B2 Antibody - N-terminal region (ARP76074_P050)

• Product Number: ARP76074_P050
• Name: CYP11B2 Antibody - N-terminal region (ARP76074_P050)
• Protein Size (# AA): 167 amino acids
• Molecular Weight: 58 kDa
• NCBI Gene Id: 1585
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Cytochrome P450, family 11, subfamily B, polypeptide 2
• Alias Symbols: CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P-450C18, P450aldo
• Peptide Sequence: Synthetic peptide located within the following region: FEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane. The enzyme has steroid 18-hydroxylase activity to synthesize aldosterone and 18-oxocortisol as well as steroid 11 beta-hydroxylase activity. Mutations in this gene cause corticosterone methyl oxidase deficiency.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: Catalog # AAP76074
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CYP11B2
• Uniprot ID: P19099
• Protein Name: cytochrome P450 11B2, mitochondrial
• Protein Accession #: NP_000489.3
• Purification: Affinity purified
• Nucleotide Accession #: NM_000498.3
• Tested Species Reactivity: Human
• Gene Symbol: CYP11B2
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Stomach Tumor
  
  Host: Rabbit
  Target Name: CYP11B2
  Sample Tissue: Human Stomach Tumor
  Antibody Dilution: 1.0ug/ml