KYAT1 Antibody - N-terminal region : FITC (ARP75980_P050-FITC)

• Product Number: ARP75980_P050-FITC
• Name: KYAT1 Antibody - N-terminal region : FITC (ARP75980_P050-FITC)
• Protein Size (# AA): 422 amino acids
• Molecular Weight: 46kDa
• Conjugation: FITC: Fluorescein Isothiocyanate
• NCBI Gene Id: 883
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: kynurenine aminotransferase 1
• Alias Symbols: GTK, KAT1, KATI, CCBL1
• Peptide Sequence: Synthetic peptide located within the following region: FDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: N/A
• Description of Target: This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene.
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-KYAT1 (ARP75980_P050-FITC) antibody is Catalog # AAP75980
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KAT1
• Uniprot ID: Q16773
• Protein Name: kynurenine--oxoglutarate transaminase 1
• Protein Accession #: NP_004050
• Purification: Affinity purified
• Gene Symbol: KYAT1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: