BIK Antibody - N-terminal region : FITC (ARP75952_P050-FITC)

Data Sheet
 
Product Number ARP75952_P050-FITC
Product Page www.avivasysbio.com/bik-antibody-n-terminal-region-fitc-arp75952-p050-fitc.html
Name BIK Antibody - N-terminal region : FITC (ARP75952_P050-FITC)
Protein Size (# AA) 160 amino acids
Molecular Weight 17kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 638
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols BP4, NBK, BIP1
Peptide Sequence Synthetic peptide located within the following region: SEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference N/A
Description of Target The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-BIK (ARP75952_P050-FITC) antibody
Blocking Peptide For anti-BIK (ARP75952_P050-FITC) antibody is Catalog # AAP75952
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human BIK
Uniprot ID Q13323
Protein Accession # NP_001188
Purification Affinity purified
Gene Symbol BIK
Predicted Species Reactivity Human
Application WB
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com