Product Number |
ARP75952_P050-FITC |
Product Page |
www.avivasysbio.com/bik-antibody-n-terminal-region-fitc-arp75952-p050-fitc.html |
Name |
BIK Antibody - N-terminal region : FITC (ARP75952_P050-FITC) |
Protein Size (# AA) |
160 amino acids |
Molecular Weight |
17kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
638 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
BP4, NBK, BIP1 |
Peptide Sequence |
Synthetic peptide located within the following region: SEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
N/A |
Description of Target |
The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-BIK (ARP75952_P050-FITC) antibody |
Blocking Peptide |
For anti-BIK (ARP75952_P050-FITC) antibody is Catalog # AAP75952 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human BIK |
Uniprot ID |
Q13323 |
Protein Accession # |
NP_001188 |
Purification |
Affinity purified |
Gene Symbol |
BIK |
Predicted Species Reactivity |
Human |
Application |
WB |
Image 1 | |
|