| Product Number |
ARP75898_P050-FITC |
| Product Page |
www.avivasysbio.com/aldoa-antibody-n-terminal-region-fitc-arp75898-p050-fitc.html |
| Name |
ALDOA Antibody - N-terminal region : FITC (ARP75898_P050-FITC) |
| Protein Size (# AA) |
364 amino acids |
| Molecular Weight |
40kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
226 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
ALDA, GSD12, HEL-S-87p |
| Peptide Sequence |
Synthetic peptide located within the following region: CIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
N/A |
| Description of Target |
The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-ALDOA (ARP75898_P050-FITC) antibody |
| Blocking Peptide |
For anti-ALDOA (ARP75898_P050-FITC) antibody is Catalog # AAP75898 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ALDOA |
| Uniprot ID |
P04075 |
| Protein Accession # |
NP_908932 |
| Purification |
Affinity purified |
| Gene Symbol |
ALDOA |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | |
|
